LL37

LL-37

Antimicrobial Defense & Wound Healing Research Peptide

Product Overview

LL-37 is a 37-amino acid, C-terminal peptide of the cathelicidin (hCAP18). In biochemical research, it is studied for its role as a primary effector molecule of the innate immune system. As an amphipathic alpha-helical peptide, LL-37 is utilized in laboratory models to investigate membrane disruption of pathogens, chemotaxis, and the modulation of inflammatory responses.

Key Research Applications

• Antimicrobial Mechanics: Used to study the “toroidal pore” model of membrane permeabilization against Gram-negative and Gram-positive bacteria.

• Wound Regeneration: Targeted in assays evaluating the proliferation and migration of keratinocytes and vascular endothelial cells.

• Immunomodulation: Utilized to observe the neutralization of lipopolysaccharides (LPS) and the activation of various signaling pathways (e.g., MAPK).

• Angiogenesis Research: Evaluated for its ability to bind to formyl peptide receptor-like 1 (FPRL1) to induce neovascularization in tissue models.

Why Researchers Choose LL-37

• High Analytical Purity: Synthesized to a verified 99% HPLC purity to ensure consistency in sensitive cellular assays.

• Native Human Sequence: Provides a high-fidelity subject for studying human-specific innate immune responses.

• Lyophilized Stability: Supplied in a freeze-dried format to ensure structural integrity and a long shelf life for laboratory storage.

Technical Specifications

• Sequence: [LL-37, 37 aa]

• Molecular Weight: 4493.33 g/mol

• CAS Number: 154947-66-7

• Purity: 99% HPLC

• Research Notice: LL-37 is strictly for laboratory and scientific research use only. It is not approved for human or animal consumption.

---

Storage & Handling Guide

To ensure the long-term stability of your experimental results, please follow these protocols:

I. Long-Term Storage (Lyophilized Powder)

• Temperature: Store at -20°C upon arrival.

• Environment: Keep in a cool, dry place away from direct light.

II. Reconstitution Protocol

• Solubility: LL-37 is generally soluble in sterile water or aqueous buffers. It is recommended to use a sterile, preservative-free diluent.

III. Storage of Reconstituted Solution

• Short-Term: Store at 2°C to 8°C and use within 7 days.

• Long-Term: Aliquot into single-use volumes and store at -20°C to avoid repeated freeze-thaw cycles.