IGF-1 LR3
$21.95 – $104.95Price range: $21.95 through $104.95
| Weight | 1 oz |
|---|
IGF-1 LR3
Engineered Insulin-Like Growth Factor-1 Variant & Muscle Development Research Compound
Product Overview
IGF-1 LR3 1mg is a highly potent, synthetic analog of human insulin-like growth factor-1. Consisting of a 13-amino acid N-terminal extension and a substitution of Arginine for Glutamic acid at position 3, this engineered variant is designed to bypass IGF-binding proteins (IGFBPs). This modification significantly increases its biological half-life and potency, making it an essential tool for investigating growth factor-related signaling and cellular development.
Key Research Applications
-
Muscle Growth & Development: Valued for its role in promoting myoblast proliferation and investigating skeletal muscle hypertrophy.
-
Metabolic Metabolism Research: Specifically targeted toward studies involving fat metabolism and its influence on energy expenditure.
-
Recovery & Repair Studies: Frequently utilized to observe cellular repair mechanisms and the regeneration of various tissue types.
-
Cognitive Function Models: Serves as a primary tool for exploring the neuroprotective effects and memory-enhancing potential of growth factors.
-
Cellular Differentiation: Evaluated for its effects on cell survival, growth, and specialized differentiation across diverse cell lines.
Why Researchers Choose IGF-1 LR3
-
Enhanced Stability & Potency: Engineered to prevent binding to inhibitory proteins, resulting in a significantly prolonged biological half-life compared to native IGF-1.
-
High Analytical Purity: Available at ≥99% purity, verified via HPLC and Mass Spectrometry to ensure consistent experimental reproducibility.
-
Reliable Format: Shipped as a lyophilized powder to ensure maximum stability during transport and laboratory storage.
Technical Specifications
-
Molecular Formula: Â C331_H519_N109_O101
-
Molecular Weight: 9117.60 g/mol
-
Sequence: MFPAMPLSSLFVNAGPVCGLRIFYNNKQYWNKPTGYGSSIRRAPQTGIVDCCFRSCDLRRLEMYCAPLKPAKSA
-
CAS Number: 946870-92-4
-
Solubility: Soluble in water or 1% acetic acid.
Research Notice: IGF-1 LR3 1mg is strictly for laboratory and scientific research use only. It is not approved for human or animal consumption, medical treatment, or therapeutic use.


Delivery
We process all orders as quickly as possible to ensure smooth and timely delivery. Orders are typically prepared and dispatched within a short processing period after confirmation. Once your order has been shipped, you will receive a confirmation email containing tracking details, allowing you to monitor the status of your delivery at any time.
Shipping
Shipping times vary depending on your location, selected shipping method, and carrier availability. We work with reliable and trusted shipping partners to ensure your order is delivered safely and securely. Please note that delivery times may be affected by factors beyond our control, such as weather conditions, public holidays, or high shipping volumes during peak periods.
