IGF-1 LR3

IGF-1 LR3

Engineered Insulin-Like Growth Factor-1 Variant & Muscle Development Research Compound

Product Overview

IGF-1 LR3 1mg is a highly potent, synthetic analog of human insulin-like growth factor-1. Consisting of a 13-amino acid N-terminal extension and a substitution of Arginine for Glutamic acid at position 3, this engineered variant is designed to bypass IGF-binding proteins (IGFBPs). This modification significantly increases its biological half-life and potency, making it an essential tool for investigating growth factor-related signaling and cellular development.

Key Research Applications

• Muscle Growth & Development: Valued for its role in promoting myoblast proliferation and investigating skeletal muscle hypertrophy.

• Metabolic Metabolism Research: Specifically targeted toward studies involving fat metabolism and its influence on energy expenditure.

• Recovery & Repair Studies: Frequently utilized to observe cellular repair mechanisms and the regeneration of various tissue types.

• Cognitive Function Models: Serves as a primary tool for exploring the neuroprotective effects and memory-enhancing potential of growth factors.

• Cellular Differentiation: Evaluated for its effects on cell survival, growth, and specialized differentiation across diverse cell lines.

Why Researchers Choose IGF-1 LR3

• Enhanced Stability & Potency: Engineered to prevent binding to inhibitory proteins, resulting in a significantly prolonged biological half-life compared to native IGF-1.

• High Analytical Purity: Available at ≥99% purity, verified via HPLC and Mass Spectrometry to ensure consistent experimental reproducibility.

• Reliable Format: Shipped as a lyophilized powder to ensure maximum stability during transport and laboratory storage.

Technical Specifications

• Molecular Formula:  C331_H519_N109_O101

• Molecular Weight: 9117.60 g/mol

• Sequence: MFPAMPLSSLFVNAGPVCGLRIFYNNKQYWNKPTGYGSSIRRAPQTGIVDCCFRSCDLRRLEMYCAPLKPAKSA

• CAS Number: 946870-92-4

• Solubility: Soluble in water or 1% acetic acid.

Research Notice: IGF-1 LR3 1mg is strictly for laboratory and scientific research use only. It is not approved for human or animal consumption, medical treatment, or therapeutic use.