LL37
$64.95
| size |
5 MG |
|---|
In stock
LL-37
Antimicrobial Defense & Wound Healing Research Peptide
Product Overview
LL-37 is a 37-amino acid, C-terminal peptide of the cathelicidin (hCAP18). In biochemical research, it is studied for its role as a primary effector molecule of the innate immune system. As an amphipathic alpha-helical peptide, LL-37 is utilized in laboratory models to investigate membrane disruption of pathogens, chemotaxis, and the modulation of inflammatory responses.
Key Research Applications
-
Antimicrobial Mechanics: Used to study the “toroidal pore” model of membrane permeabilization against Gram-negative and Gram-positive bacteria.
-
Wound Regeneration: Targeted in assays evaluating the proliferation and migration of keratinocytes and vascular endothelial cells.
-
Immunomodulation: Utilized to observe the neutralization of lipopolysaccharides (LPS) and the activation of various signaling pathways (e.g., MAPK).
-
Angiogenesis Research: Evaluated for its ability to bind to formyl peptide receptor-like 1 (FPRL1) to induce neovascularization in tissue models.
Why Researchers Choose LL-37
-
High Analytical Purity: Synthesized to a verified 99% HPLC purity to ensure consistency in sensitive cellular assays.
-
Native Human Sequence: Provides a high-fidelity subject for studying human-specific innate immune responses.
-
Lyophilized Stability: Supplied in a freeze-dried format to ensure structural integrity and a long shelf life for laboratory storage.
Technical Specifications
-
Sequence: [LL-37, 37 aa]
-
Molecular Weight: 4493.33 g/mol
-
CAS Number: 154947-66-7
-
Purity: 99% HPLC
-
Research Notice: LL-37 is strictly for laboratory and scientific research use only. It is not approved for human or animal consumption.
Storage & Handling Guide
To ensure the long-term stability of your experimental results, please follow these protocols:
I. Long-Term Storage (Lyophilized Powder)
-
Temperature: Store at -20°C upon arrival.
-
Environment: Keep in a cool, dry place away from direct light.
II. Reconstitution Protocol
-
Solubility: LL-37 is generally soluble in sterile water or aqueous buffers. It is recommended to use a sterile, preservative-free diluent.
III. Storage of Reconstituted Solution
-
Short-Term: Store at 2°C to 8°C and use within 7 days.
-
Long-Term: Aliquot into single-use volumes and store at -20°C to avoid repeated freeze-thaw cycles.

Delivery
We process all orders as quickly as possible to ensure smooth and timely delivery. Orders are typically prepared and dispatched within a short processing period after confirmation. Once your order has been shipped, you will receive a confirmation email containing tracking details, allowing you to monitor the status of your delivery at any time.
Shipping
Shipping times vary depending on your location, selected shipping method, and carrier availability. We work with reliable and trusted shipping partners to ensure your order is delivered safely and securely. Please note that delivery times may be affected by factors beyond our control, such as weather conditions, public holidays, or high shipping volumes during peak periods.
RELATED PRODUCTS
AOD9604
$52.95BPC-157 + TB-500
$49.95 – $89.95Price range: $49.95 through $89.95
